PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0085s0410.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 248aa    MW: 27496 Da    PI: 8.2696
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0085s0410.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM107.12.1e-33108850129
                     NAM  50 kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                             +++ + +ewyf+s+rd+kyatg r+nrat+sgyWkatgkd++vl+ kg+lvg++ktLvfy+grapkg++tdWvmhe+rle
  SapurV1A.0085s0410.2.p  10 AARVGGREWYFYSQRDRKYATGLRTNRATASGYWKATGKDRHVLR-KGTLVGMRKTLVFYQGRAPKGKRTDWVMHEFRLE 88 
                             4556789*************************************9.999****************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100539.3661111IPR003441NAC domain
SuperFamilySSF1019411.96E-397111IPR003441NAC domain
PfamPF023652.8E-151787IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MCVCGNLAEA ARVGGREWYF YSQRDRKYAT GLRTNRATAS GYWKATGKDR HVLRKGTLVG  60
MRKTLVFYQG RAPKGKRTDW VMHEFRLEEP LGPPKLSSDK EDWVLCRVFY KSSREAAAKP  120
STGSCNDDAS SSSLPPLMES YITFEQTQPN SDEHEQVPCF SIFSQNQNLL APYITPMEVP  180
NAPTMDITSC NPLDSVSCDT KVLKAVLNNL AKMESYASFK GSPSLGEGSS ESYISGVGMS  240
NLWSHHH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-33711362167NO APICAL MERISTEM PROTEIN
1ut4_B2e-33711362167NO APICAL MERISTEM PROTEIN
1ut7_A2e-33711362167NO APICAL MERISTEM PROTEIN
1ut7_B2e-33711362167NO APICAL MERISTEM PROTEIN
3swm_A3e-33711365170NAC domain-containing protein 19
3swm_B3e-33711365170NAC domain-containing protein 19
3swm_C3e-33711365170NAC domain-containing protein 19
3swm_D3e-33711365170NAC domain-containing protein 19
3swp_A3e-33711365170NAC domain-containing protein 19
3swp_B3e-33711365170NAC domain-containing protein 19
3swp_C3e-33711365170NAC domain-containing protein 19
3swp_D3e-33711365170NAC domain-containing protein 19
4dul_A2e-33711362167NAC domain-containing protein 19
4dul_B2e-33711362167NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002307195.21e-150hypothetical protein POPTR_0005s10100g
SwissprotQ84TE61e-84NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLB9H6401e-150B9H640_POPTR; Uncharacterized protein
STRINGPOPTR_0005s10100.11e-149(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56010.19e-80NAC domain containing protein 1